About Services Proteins Contact

AF_1095

Gene
AF_1095
Protein
Putative antitoxin AF_1095
Organism
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Length
62 amino acids
Function
Possibly the antitoxin component of a type II toxin-antitoxin (TA) system.
Similarity
Belongs to the UPF0165 family.
Mass
7.435 kDa
Sequence
MPKIIEAIYENGVFKPLQKVDLKEGERIKLRIEEGILDVIKKYQGKFKLTEKDIEKFLEERR