About Services Proteins Contact

AF_0860

Gene
AF_0860
Protein
Uncharacterized protein AF_0860
Organism
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Length
89 amino acids
Mass
10.38 kDa
Sequence
MVNHPCIVQVRDVQPDKIEIVRNMALKRNAEVEKAKNGLDIYFEDVNEARKFISKLRKSMKLRIKMSTKYAGLRGSRVRVLFVYSLRGL