About Services Proteins Contact

AF_0241

Gene
AF_0241
Protein
S-adenosyl-L-methionine-binding protein AF_0241
Organism
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Length
139 amino acids
Mass
15.809 kDa
Sequence
MILKPIGVVKSPFKTQNDAPRQGRFSDAVSEIAIFDEYADGLHKIENLRHIIVLYWMDKASRDKLRVVPPGETEERGVFTTRSPSRPNPIGLCVVEILEVERNRLKVRWLDALDGSPVIDIKKYSPEIDCVNQLEGQQP