About Services Proteins Contact

AF_0059

Gene
AF_0059
Protein
Uncharacterized protein AF_0059
Organism
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Length
134 amino acids
Mass
15.43 kDa
Sequence
MYRYPVEVIADTYLSKVGGYSYELDRNEIGINVKALEMNTSIIANETLATLKRFEEIRPYFLRRKFVVVGIEESMDCYEMSANGEVVLPEEMEGSMEVGESVIVNTVEAFRIDGDYSNIIKAIKWRLDNQILRN