ADIPOR1

Heptahelical transmembrane protein ADIPOR1

376 amino acids

May play a role in abiotic stress response.

Belongs to the ADIPOR family.

41.358 kDa

MGEEAAMATMESAYHDELAPAAAPAPAKGGGSKKKRKQQKREEKRKECRLVSYHELPDYMKENEFILDYYRSEWPILNALLSLFSWHNETINIWTHLLGFVLFFGLTVLHLGQYFPQVADLIGHLSWPISKVAENVSSNIGDVLSGAASFMQASPASSAGAMAAAWPVTAAAAATTRWPFFVFLAGAMFCLLSSAACHLLSCHSHRLNLFLIRLDYTGIAVMIVVSFFPPIYYIFQCEPRWQVVYLSAITAAGVATVYALMSPRLSAARYRAHRALLFVAMGLSGVVPAAHAVAVNWHEPRRNVTLAYEGAMAASYLAGTAFYLTRVPERWRPGMFDLCGHSHQIFHALVIAGALAHYAAAIVFIQARDEMGCPAP

ADIPOR1

Adiponectin receptor protein 1

375 amino acids

Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism (PubMed:25855295, PubMed:12802337). Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin (By similarity).

Belongs to the ADIPOR family.

42.616 kDa

MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL

Adipor1

Adiponectin receptor protein 1

375 amino acids

Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism (PubMed:17327425, PubMed:17268472, PubMed:24742672). Required for normal glucose and fat homeostasis and for maintaining a normal body weight (PubMed:17327425, PubMed:24742672). ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis (PubMed:12802337, PubMed:17327425, PubMed:17268472, PubMed:24742672). Has high affinity for globular adiponectin and low affinity for full-length adiponectin (PubMed:12802337).

Belongs to the ADIPOR family.

42.366 kDa

MSSHKGSAGAQGNGAPSGNREADTVELAELGPLLEEKGKRAASSPAKAEEDQACPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDSLL