About Services Proteins Contact

ADF1

Gene
ADF1
Protein
Adherence factor
Organism
Candida albicans (strain SC5314 / ATCC MYA-2876)
Length
612 amino acids
Function
Surface antigen mediating adhesion and aggregation in S.cerevisiae.
Mass
68.794 kDa
Sequence
MSSFNSNSNPANAQNLSSFQFQPPKEDVIFDTHQMSLSVPQSRYYASSMMQQSQQGQPQSQTSQQQQQQPFLMNIPPAFTQTQPQQMLYAMPPLQTQQPSSSSATTNNVVPPHHYNQQQSQQQQQQQQQYQQMQPQPNNMQFFDNTIPNYLIMNQTISPSQTQTTAQPNISYYNYSTQPQLQSAQPISHSQPQPQPQATQPRSNRSRSQTSFSKPRGSRQVSGSGRSTGAKKQSAITSGSTGTGPARNADTGMTSVANSTSTTTMTTTNNNNKLSVSAPVNVIYANLPERLQQVLPAPPLSRAPVRPDVTVNLTSKRAKRKSKFTPEQDDMIVNLKKKGKSWVEIAEITGVGSYLAARNRFQVIVGQQGNNNSSAWDNTDKLFLNQLLDAGEIEKWRFICCELNKSTNKNFTDYECREMIRQLFWLNPASFGVNEETIIESQKEKKLTEKTIEQREQQRKKRASANHSPPDSDSITNTNNNQQEVKYIDPQYKNYQSQLMPNQNTGSGATKISSTTPPPPSQALSNNVNTMNKNIVSSALGGTSFSQEQHSLHSNQHHHNHQQHPLIHHHQYQQQSSLPPPPTIPSTIPTSSLSIQQQQQQQQQQLYNKQFY

Gene
Adf1
Protein
Transcription factor Adf-1
Organism
Drosophila melanogaster
Length
262 amino acids
Function
May play an important role not only in the regulation of Adh expression but also in the transcription of other genes.
Mass
30.188 kDa
Sequence
MHTLTAAIEMDKLDANLEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQESRWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQTVVDIFAQPFNGSATTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDNMLNTIKIFQNNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLAQHNKY

Gene
ADF1
Protein
Actin-depolymerizing factor 1
Organism
Arabidopsis thaliana
Length
139 amino acids
Function
Actin-depolymerizing protein. Stimulates F-actin depolymerization. Involved in plant development, cell organ expansion and flowering by controlling breakdown of thick actin cables (PubMed:11402164). Severs actin filaments or bundles and promotes actin cytoskeleton disassembly (PubMed:21570971). Binds monomeric actin (G-actin) with a marked preference for the ADP-loaded form and inhibits the rate of nucleotide exchange on G-actin (PubMed:17538023).
Similarity
Belongs to the actin-binding proteins ADF family.
Mass
16.113 kDa
Sequence
MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGQPIQTYEEFAACLPADECRYAIYDFDFVTAENCQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQVELQATDPTEMDLDVFRSRAN

Gene
ADF1
Protein
Actin-depolymerizing factor 1
Organism
Zea mays
Length
139 amino acids
Function
Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers (By similarity).
Similarity
Belongs to the actin-binding proteins ADF family.
Mass
16.168 kDa
Sequence
MANSSSGLAVNDECKVKFRELKSRRTFRFIVFRIDDTDMEIKVDRLGEPNQGYGDFTDSLPANECRYAIYDLDFTTIENCQKSKIFFFSWSPDTARTRSKMLYASSKDRFRRELDGIQCEIQATDPSEMSLDIVRSRTN

Gene
ADF1
Protein
Actin-depolymerizing factor 1
Organism
Oryza sativa subsp. japonica
Length
139 amino acids
Function
Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers (By similarity).
Similarity
Belongs to the actin-binding proteins ADF family.
Mass
15.936 kDa
Sequence
MSNSASGMAVCDECKLKFLELKAKRSFRFIVFKINEKVQQVVVDRLGQPGESYDDFTACLPADECRYAVFDFDFVTDENCQKSKIFFISWAPDTSRVRSKMLYASSKDRFKRELDGIQVELQATDPSEMSMDIVKSRAL

Gene
ADF1
Protein
Actin-depolymerizing factor 1
Organism
Petunia hybrida
Length
139 amino acids
Function
Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers (By similarity).
Similarity
Belongs to the actin-binding proteins ADF family.
Mass
16.041 kDa
Sequence
MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVVVEKIGEPTESYEDFAASLPENECRYAVYDFDFVTAENCQKSRIFFIAWCPDTARVRSKMIYASSKDRFKRELDGIQVELQACDPTEMGLDVIQSRAN

Gene
ADF1
Protein
Antisense of depressing factor protein 1
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
113 amino acids
Function
Transcriptional repressor which negatively regulates transcription of FYV5 by binding to the promoter on the sense strand.
Similarity
Belongs to the ADF1 family.
Mass
12.739 kDa
Sequence
MGKCSMKKKGVGKNVGVGKKVQKKRSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQEPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL