Function
Required for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known (By similarity). ADA2 stimulates the acetyltransferase activity of GCN5 on free histones or nucleosomes, probably by opening up the promoter region. Mediates auxin and cytokinin signals in the control of cell proliferation and might be involved in repression of a freezing tolerance pathway at warm temperature (PubMed:12615937, PubMed:12747832). Involved in the positive regulation of salt-induced gene expression by maintaining locus-specific acetylation of histones H4 and H3 (PubMed:21193996).
Sequence
MGRSRGNFQNFEDPTQRTRKKKNAANVENFESTSLVPGAEGGGKYNCDYCQKDITGKIRIKCAVCPDFDLCIECMSVGAEITPHKCDHPYRVMGNLTFPLICPDWSADDEMLLLEGLEIYGLGNWAEVAEHVGTKSKEQCLEHYRNIYLNSPFFPLPDMSHVAGKNRKELQAMAKGRIDDKKAEQNMKEEYPFSPPKVKVEDTQKESFVDRSFGGKKPVSTSVNNSLVELSNYNQKREEFDPEYDNDAEQLLAEMEFKENDTPEEHELKLRVLRIYSKRLDERKRRKEFIIERNLLYPNPFEKDLSQEEKVQCRRLDVFMRFHSKEEHDELLRNVVSEYRMVKRLKDLKEAQVAGCRSTAEAERYLGRKRKRENEEGMNRGKESGQFGQIAGEMGSRPPVQASSSYVNDLDLIGFTESQLLSESEKRLCSEVKLVPPVYLQMQQVMSHEIFKGNVTKKSDAYSLFKIDPTKVDRVYDMLVKKGIAQL