AC4

Protein AC4

183 amino acids

Pathogenicity determinant (By similarity). May act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

Belongs to the geminiviridae protein AC4/C4 family.

20.865 kDa

MPFRDTYIMSPINRRRCSRVSLVECLQLTWSTXELLVFEFKPRMSFSHTQSVLYPKNTYCHSFKHFLSNQTLSSLKSVESCIRMGNLTCMPSFNSRVKSRLRTIVSSIVYTQAVAPVSTPTFKVPNQARMSSPIWIRTATPSNGDNFKSMDDLLEAVNNQRMMLTPKRLTAAVSQKLLMSLGN

AC4

Protein AC4

179 amino acids

Pathogenicity determinant (By similarity). May act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

Belongs to the geminiviridae protein AC4/C4 family.

20.451 kDa

MPFGDNYIMSPINRRRCSRVSPVECLQLTWSKCELLVLEFKPRMSFSHTQIVLYPKNTCCHSFKHYLSHQTLSSLKSVESCIRMGNLTCMPSSNSRERSRLRTIVSSIVYTQAVAPISTPTFKVPNQAQMSSPIWIRTETPSNGDNFRSMDDLLEAVNNQRMMLTPKRLTAAVSQKLLM

AC4

Protein AC4

125 amino acids

Pathogenicity determinant (By similarity). May act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

Belongs to the geminiviridae protein AC4/C4 family.

14.179 kDa

MFPKKKFLRCFCISRGRSSNRITLESPERNIPTGLRTYTASFNYLENPTSRMLDFSTSLTPDGLPDFTQTFRLPKTPTPSRTTSPKKVIIVNPGNIKCLGVQSQTKTTYITMPLMQVVREKLSTL

AC4

Protein AC4

121 amino acids

Pathogenicity determinant (By similarity). May act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

Belongs to the geminiviridae protein AC4/C4 family.

13.744 kDa

MKLFRCFKPCRGQSSNPHTSESQERNIQTGSPIYTVSSNYQESRTSRMLDFSTSLTPEGLPIFTQTFRQPKTPMPSRITSPKMVIIVNPGSTRCLGVQRQIKTTSTTTPSMRDVWKRLSQL

AC4

Protein AC4

102 amino acids

Pathogenicity determinant (By similarity). May act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

Belongs to the geminiviridae protein AC4/C4 family.

11.27 kDa

MRMGSLICTCSSSSKANTNARISDSSTWYHQPGQHISIQTFRELNPAPTSSPTSTRTVILGDGEHFRSMDDQPEGVNNLQTTLTPRHLTAAVNQRLLRSLEN

AC4

Protein AC4

99 amino acids

Pathogenicity determinant (By similarity). May act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

Belongs to the geminiviridae protein AC4/C4 family.

11.51 kDa

MKMENLISMFCFSSKGSSKRRTKGSSTWFPQPDQHITIRTFRRLKAHQMLSHTWTKTETSLTMEVSKSMADQLEEVNSLPTTLMPRHSIVDPSYRPSIY

AC4

Protein AC4

85 amino acids

Pathogenicity determinant (By similarity). May act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

Belongs to the geminiviridae protein AC4/C4 family.

9.416 kDa

MGNLISTFLSSSKGNSTAQITDCSIWCPRPGQHISIRTFRELNRAPMSNPTSRKTGTVSNGDCSRLTEEVLEADSRHQTTQLPRH

AC4

Protein AC4

85 amino acids

Pathogenicity determinant (By similarity). May act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. May repress the AL61 promoter.

Belongs to the geminiviridae protein AC4/C4 family.

9.757 kDa

MGNLTSTCLFSSRENTAAKINDSSTWYPQQGQHISIQTFRELNRLPTSRRTSTKTEILLYGENSRSTVEVLEEVAKHLTTLQQRR

AC4

Protein AC4

79 amino acids

Pathogenicity determinant (By similarity). May act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

Belongs to the geminiviridae protein AC4/C4 family.

8.772 kDa

MCSYSSKANTNARITDSSIWSPQPGQHISIQTYRELNPAPTSSPTSTRTEIQLNGENSRSTADLPGEANRLLMIHMPRR

AC4

Protein AC4

79 amino acids

Pathogenicity determinant. May act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

Belongs to the geminiviridae protein AC4/C4 family.

8.897 kDa

MRLFSSKVNSSAQIKDCSTWYPQPGQHISIRTFRELNQVPTSKNTSTKMESQSNGDNSKSTADLQEEVSSLPTTHTQRH

AC4

Protein AC4

79 amino acids

Pathogenicity determinant (By similarity). May act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

Belongs to the geminiviridae protein AC4/C4 family.

8.897 kDa

MRLFSSKVNSSAQIKDCSTWYPQPGQHISIRTFRELNQVPTSKNTSTKMESQSNGDNSKSTADLQEEVSSLPTTHTQRH

AC4

Protein AC4

60 amino acids

Pathogenicity determinant (By similarity). May act as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.

Belongs to the geminiviridae protein AC4/C4 family.

6.746 kDa

MKMGNLICTCLFSSKENTNARTTDSLTSYPLPDQHISIRTFRELNQAPTSRRTSTKTAIP