About Services Proteins Contact

ABBFA_001813

Gene
ABBFA_001813
Protein
Nucleoid-associated protein ABBFA_001813
Organism
Acinetobacter baumannii (strain AB307-0294)
Length
109 amino acids
Function
Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection.
Similarity
Belongs to the YbaB/EbfC family.
Mass
12.015 kDa
Sequence
MNINMLMQQAQRMQKDMESNIKKAKEELAQTEVHAEAGGGLVKVTMTGRYIVKRIEINPELLQDEPDMIEDLIAAAVNDAVRQAEVVSEEKMQKANSGMGLPPGLAGMF