About Services Proteins Contact

ABAYE3291

Gene
ABAYE3291
Protein
PKHD-type hydroxylase ABAYE3291
Organism
Acinetobacter baumannii (strain AYE)
Length
227 amino acids
Mass
26.169 kDa
Sequence
MIHHIPNVLSKEQVQYFRNEMDKIEWVNGKVTAGTLSATVKRNQQLPEDHPLTHHLSNIILEALGTHPLFLSAAIPLDIIPPLFNRYENQESFGFHVDNSIRRIRGTNERLRTDLSCTLFLSEPEEYEGGDLVVEDTYGYHEVKLPAGDMILYPSTSLHEVTAITSGCRIASFFWVQSMVRDDAERHMLFNLDQTVQNLRMQLGDNHSEVIKLTNLYHNLMRKWAEL