About Services Proteins Contact

AAEL011789

Gene
AAEL011789
Protein
Probable citrate synthase 2, mitochondrial
Organism
Aedes aegypti
Length
467 amino acids
Similarity
Belongs to the citrate synthase family.
Mass
51.641 kDa
Sequence
MALSRIYSSKLASANKNLLPVITTYVRNASDSTDLKAVLSEKIPKEQERVKNFRKQFGATKVGEVTVDMMYGGMRGIKGLVCETSVLDPDEGIRFRGLSIPECQKVLPKAPGGAEPLPEGLFWLLITGDVPTKAQVDALSREWANRAALPSHVVTMLNNMPTTLHPMSQLSCAVTALNHESKYAKAYSEGVHKSKYWEYVYEDSMDLIAKLPVVAATIYRNTYRDGKGIGAIDPKKDWSANFTKMLGYEDEQFTELMRLYLTIHSDHEGGNVSAHTVHLVGSALSDPYLSFAAGMNGLAGPLHGLANQEVLVWLQKLRKELGDNASEDKVKDFIWKTLKSGQVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPLFQLVSNIYKVVPPILTELGKVKNPWPNVDAHSGVLLQYYGLKEMNYYTVLFGVSRALGVLASLVWDRALGLPIERPKSMSTDGLMKAVGAAK